PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009770451.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 564aa    MW: 63929.3 Da    PI: 7.3195
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009770451.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.84.4e-094825201854
                     HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     +F++  ++yp+ +e++ LA k gLt +qV++WF N R +
  XP_009770451.1 482 MFQNflHPYPKDAEKQLLAVKSGLTRSQVSNWFINARVR 520
                     5887779******************************88 PP

2BELL64.71.9e-21355415364
            BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcL 64 
                     ++ ++kk +L+ ll+ Vd++Y+q+ +++++vis+F+av++l++  +++++Al++iS  +++L
  XP_009770451.1 355 MDSEAKKKHLVALLQVVDDQYNQCLDEIHMVISAFHAVTELDP-SIHARFALQTISSLYKNL 415
                     67899**************************************.9****************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.0E-12289425IPR006563POX domain
PfamPF075267.3E-23295415IPR006563POX domain
PROSITE profilePS5007111.224461524IPR001356Homeobox domain
SMARTSM003895.5E-7464528IPR001356Homeobox domain
CDDcd000863.16E-11464525No hitNo description
SuperFamilySSF466891.67E-15466533IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.3E-26467530IPR009057Homeodomain-like
PfamPF059204.1E-15481520IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 564 aa     Download sequence    Send to blast
MAEPHPIIDE NLLHTASIPI SFPDRIGLNN QNHIMDGQNH IMDGHEIPIP FMLQGEAINS  60
SQAFLSLPNF PRAVDNGAIH NVLPMRNRTK EFLLSTSYPI SNSYTEDQYM EGIPISALSL  120
ANLLATRNAM PENHENLAAL DPLSHPVEGH KTDVLDYPTM LSHSFGSYRN YEFDSVPEIA  180
GTVAGRTGSQ PFQLTHENVN SNTWFSSETA SMSSDSPSGS SSRFSNELSL SLTSTQSAVA  240
CGTTIRDQCS DISCSGVTNH AFPQRRFDSE LTSCNSRNLS LNFGSYKPVH LSQFLTGSRY  300
LRVMQEILSE MAHLSLQNHN LVGYRGNGTE YGANTSFTLS SDDLPDEDCR IIGQMDSEAK  360
KKHLVALLQV VDDQYNQCLD EIHMVISAFH AVTELDPSIH ARFALQTISS LYKNLXGENK  420
XLHTRDGRTF XXRRKGSREI XLKHRSFKNS GHFXQLKRKD HQLWRPQRGL PERSVSVLRA  480
WMFQNFLHPY PKDAEKQLLA VKSGLTRSQV SNWFINARVR LWKPMIEEMY AEMNRRKIRT  540
GNHEDETNNR RNHKIIDNRL FTMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-14470528563Homeobox protein Meis2
3k2a_B1e-14470528563Homeobox protein Meis2
4xrs_A9e-15470527158Homeobox protein Meis1
4xrs_B9e-15470527158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009770451.10.0PREDICTED: LOW QUALITY PROTEIN: homeobox protein ATH1
SwissprotP487314e-93ATH1_ARATH; Homeobox protein ATH1
TrEMBLK4CLC20.0K4CLC2_SOLLC; Uncharacterized protein
TrEMBLM1CXR70.0M1CXR7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000769950.0(Solanum tuberosum)
STRINGSolyc08g065420.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82612327
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.14e-92homeobox gene 1